PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TCP
Protein Properties Length: 380aa    MW: 40749.9 Da    PI: 6.7956
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-29754PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP127.41.4e-3977151279
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                ++k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pa++++tgt++++a+++   s +
  Vun007295  77 PPKRTSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT---SLN 151
                789*************************************************************99988776...222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-3481154IPR005333Transcription factor, TCP
PROSITE profilePS5136927.92383137IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDGGDDFHHH HHHHQHQHRQ NFPFQLLEKK EDQDPSSCST SSPYPSLAIS AEPSTSNSTR  60
STTLLPTPSE ASPKKPPPKR TSTKDRHTKV DGRGRRIRMP ALCAARVFQL TRELGHKSDG  120
ETIEWLLQQA EPAVIAATGT GTIPANFTSL NNLTGAPAPP CPSPPSCDPT TSIPTSLSNP  180
GEACSLTTPI PPPHSSIFNP TTPSPLPYSQ PKHELRDSSS LDLSSENNEE GLGRKRRPLE  240
QDLSSTMQHH VGSYSMQSSS SGTIPASHAQ IPANIWMVAN SNSQGVSGEA PLWTFPGVSN  300
SALYRGNMSS GLHFMNFPTP MALLPGQQLG SSGIGGNINE GHLSMLSGLN PYRTVIGVSE  360
SQASESQSHH GGSEDRHDDN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138192.10.0hypothetical protein PHAVU_009G188100g
SwissprotQ93Z002e-61TCP14_ARATH; Transcription factor TCP14
TrEMBLV7B1710.0V7B171_PHAVU; Uncharacterized protein
STRINGGLYMA06G20660.11e-146(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.13e-43TCP family protein